![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins) members of this "family" may be more closely related to other ferredoxins than to each other |
![]() | Protein Respiratory nitrate reductase 1 beta chain [102955] (2 species) |
![]() | Species Escherichia coli K-12 [TaxId:83333] [189178] (3 PDB entries) |
![]() | Domain d3ir6b_: 3ir6 B: [178574] Other proteins in same PDB: d3ir6a1, d3ir6a2, d3ir6c_ automated match to d1q16b_ complexed with aga, f3s, gdp, hem, sf4; mutant |
PDB Entry: 3ir6 (more details), 2.8 Å
SCOPe Domain Sequences for d3ir6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ir6b_ d.58.1.5 (B:) Respiratory nitrate reductase 1 beta chain {Escherichia coli K-12 [TaxId: 83333]} mkirsqvgmvlnldkcigchtcsvtcknvwtsregveyawfnnvetkpgqgfptdwenqe kykggwirkingklqprmgnramllgkifanphlpgiddyyepfdfdyqnlhtapegsks qpiarprslitgermakiekgpnweddlggefdklakdknfdniqkamysqfentfmmyl prlcehclnpacvatcpsgaiykreedgivlidqdkcrgwrmcitgcpykkiyfnwksgk sekcifcyprieagqptvcsetcvgrirylgvllydadaieraastenekdlyqrqldvf ldpndpkvieqaikdgiplsvieaaqqspvykmamewklalplhpeyrtlpmvwyvppls piqsaadagelgsngilpdveslripvqylanlltagdtkpvlralkrmlamrhykraet vdgkvdtraleevglteaqaqemyrylaianyedrfvvpsshrelareafpekngcgftf gdgchgsdtkfnlfnsrridaidvtskte
Timeline for d3ir6b_: