SCOPe 2.08: Domain d3iqob_: 3iqo B:

Lineage for d3iqob_ (3iqo B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Cow (Bos taurus), s100b [TaxId:9913] [47482] (26 PDB entries)

8. Domain d3iqob_: 3iqo B: [178562]
   automated match to d1cfpa_
   complexed with ca

Details for d3iqob_

PDB Entry: 3iqo, 1.5 Å

PDB Description: 1.5 angstrom x-ray structure of bovine ca(2+)-s100b

PDB Compounds: (B:) Protein S100-B

SCOPe Domain Sequences for d3iqob_:

Sequence; same for both SEQRES and ATOM records:

>d3iqob_ a.39.1.2 (B:) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}
selekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dsdgdgecdfqefmafvamittacheff

Timeline for d3iqob_:

• d3iqob_ first appeared in SCOPe 2.01
  
• d3iqob_ appears in SCOPe 2.07