Lineage for d3iqoa_ (3iqo A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 914068Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 914069Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 914095Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 914096Protein Calcyclin (S100) [47479] (17 species)
  7. 914097Species Cow (Bos taurus), s100b [TaxId:9913] [47482] (14 PDB entries)
  8. 914098Domain d3iqoa_: 3iqo A: [178561]
    automated match to d1cfpa_
    complexed with ca

Details for d3iqoa_

PDB Entry: 3iqo (more details), 1.5 Å

PDB Description: 1.5 angstrom x-ray structure of bovine ca(2+)-s100b
PDB Compounds: (A:) Protein S100-B

SCOPe Domain Sequences for d3iqoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iqoa_ a.39.1.2 (A:) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}
selekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmetl
dsdgdgecdfqefmafvamittacheff

SCOPe Domain Coordinates for d3iqoa_:

Click to download the PDB-style file with coordinates for d3iqoa_.
(The format of our PDB-style files is described here.)

Timeline for d3iqoa_: