Lineage for d3iqlb_ (3iql B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1120542Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1120633Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1120995Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1120996Protein automated matches [190457] (5 species)
    not a true protein
  7. 1121041Species Norway rat (Rattus norvegicus) [TaxId:10116] [189104] (2 PDB entries)
  8. 1121043Domain d3iqlb_: 3iql B: [178560]
    automated match to d1k76a_
    complexed with cl

Details for d3iqlb_

PDB Entry: 3iql (more details), 1.4 Å

PDB Description: Crystal structure of the rat endophilin-A1 SH3 domain
PDB Compounds: (B:) Endophilin-A1

SCOPe Domain Sequences for d3iqlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iqlb_ b.34.2.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
asvgsdqpccralydfepenegelgfkegdiitltnqidenwyegmlhgqsgffpinyve
ilvalph

SCOPe Domain Coordinates for d3iqlb_:

Click to download the PDB-style file with coordinates for d3iqlb_.
(The format of our PDB-style files is described here.)

Timeline for d3iqlb_: