SCOPe 2.01: Domain d3iqlb_: 3iql B:

Lineage for d3iqlb_ (3iql B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (5 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [189104] (1 PDB entry)

8. Domain d3iqlb_: 3iql B: [178560]
   automated match to d1k76a_
   complexed with cl

Details for d3iqlb_

PDB Entry: 3iql, 1.4 Å

PDB Description: Crystal structure of the rat endophilin-A1 SH3 domain

PDB Compounds: (B:) Endophilin-A1

SCOPe Domain Sequences for d3iqlb_:

Sequence; same for both SEQRES and ATOM records:

>d3iqlb_ b.34.2.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
asvgsdqpccralydfepenegelgfkegdiitltnqidenwyegmlhgqsgffpinyve
ilvalph

Timeline for d3iqlb_:

• d3iqlb_ is new in SCOPe 2.01-stable
  
• d3iqlb_ appears in SCOPe 2.02
  
• d3iqlb_ appears in the current release, SCOPe 2.08, called d3iqlb1