Lineage for d3iqgx_ (3iqg X:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2156898Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2156899Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2156900Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 2157154Protein automated matches [190054] (13 species)
    not a true protein
  7. 2157177Species Haemophilus influenzae [TaxId:727] [189119] (3 PDB entries)
  8. 2157180Domain d3iqgx_: 3iqg X: [178554]
    automated match to d1y7la1

Details for d3iqgx_

PDB Entry: 3iqg (more details), 1.9 Å

PDB Description: Structure of O-Acetylserine Sulfhydrylase in Complex with Peptide MNWNI
PDB Compounds: (X:) Cysteine synthase

SCOPe Domain Sequences for d3iqgx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iqgx_ c.79.1.1 (X:) automated matches {Haemophilus influenzae [TaxId: 727]}
aiyadnsysigntplvrlkhfghngnvvvkiegrnpsysvkcriganmvwqaekdgtltk
gkeivdatsgntgialayvaaargykitltmpetmslerkrllcglgvnlvltegakgmk
gaiakaeeivasdpsryvmlkqfenpanpqihrettgpeiwkdtdgkvdvvvagvgtggs
itgisraikldfgkqitsvavepvespvisqtlageevkpgphkiqgigagfipknldls
iidrvetvdsdtalatarrlmaeegilagissgaavaaadrlaklpefadklivvilpsa
serylstalf

SCOPe Domain Coordinates for d3iqgx_:

Click to download the PDB-style file with coordinates for d3iqgx_.
(The format of our PDB-style files is described here.)

Timeline for d3iqgx_: