Lineage for d3iqfc_ (3iqf C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2151434Fold c.127: F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) [102323] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213456
  4. 2151435Superfamily c.127.1: F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) [102324] (1 family) (S)
    the sheet topology is similar to those of the Periplasmic binding protein-like I domains
    automatically mapped to Pfam PF01993
  5. 2151436Family c.127.1.1: F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) [102325] (1 protein)
  6. 2151437Protein F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) [102326] (1 species)
  7. 2151438Species Methanopyrus kandleri [TaxId:2320] [102327] (7 PDB entries)
  8. 2151453Domain d3iqfc_: 3iqf C: [178544]
    automated match to d1qv9a_
    complexed with ca, e4m, na

Details for d3iqfc_

PDB Entry: 3iqf (more details), 2.1 Å

PDB Description: Structure of F420 dependent methylene-tetrahydromethanopterin dehydrogenase in complex with methenyl-tetrahydromethanopterin
PDB Compounds: (C:) F420-dependent methylenetetrahydromethanopterin dehydrogenase

SCOPe Domain Sequences for d3iqfc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iqfc_ c.127.1.1 (C:) F420-dependent methylenetetrahydromethanopterin dehydrogenase (MTD) {Methanopyrus kandleri [TaxId: 2320]}
tvakaifikcgnlgtsmmmdmllderadredvefrvvgtsvkmdpecveaavemaldiae
dfepdfivyggpnpaapgpskaremladseypaviigdapglkvkdemeeqglgyilvkp
damlgarrefldpvemaiynadlmkvlaatgvfrvvqeafdeliekakedeisendlpkl
vidrntllereefenpyamvkamaaleiaenvadvsvegcfveqdkeryvpivasahemm
rkaaeladeareleksndavlrtphapdgkvlskrkfmedpe

SCOPe Domain Coordinates for d3iqfc_:

Click to download the PDB-style file with coordinates for d3iqfc_.
(The format of our PDB-style files is described here.)

Timeline for d3iqfc_: