![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.19: Flagellar export chaperone FliS [101116] (2 families) ![]() can form closed, open and helix-swapped bundles |
![]() | Family a.24.19.0: automated matches [191633] (1 protein) not a true family |
![]() | Protein automated matches [191166] (1 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:85962] [189381] (2 PDB entries) |
![]() | Domain d3iqcb_: 3iqc B: [178535] automated match to d1vh6b_ |
PDB Entry: 3iqc (more details), 2.7 Å
SCOPe Domain Sequences for d3iqcb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iqcb_ a.24.19.0 (B:) automated matches {Helicobacter pylori [TaxId: 85962]} pakliemlyegilrfssqakrcienediekkiyyinrvtdiftellnildyekggevavy ltglythqikvltqanvendaskidlvlnvarglleawrei
Timeline for d3iqcb_: