Lineage for d3iqca_ (3iqc A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2313956Superfamily a.24.19: Flagellar export chaperone FliS [101116] (2 families) (S)
    can form closed, open and helix-swapped bundles
  5. 2313968Family a.24.19.0: automated matches [191633] (1 protein)
    not a true family
  6. 2313969Protein automated matches [191166] (3 species)
    not a true protein
  7. 2313973Species Helicobacter pylori [TaxId:85962] [189381] (2 PDB entries)
  8. 2313974Domain d3iqca_: 3iqc A: [178534]
    automated match to d1vh6b_

Details for d3iqca_

PDB Entry: 3iqc (more details), 2.7 Å

PDB Description: Crystal structure of FliS from H. pylori
PDB Compounds: (A:) Flagellar protein

SCOPe Domain Sequences for d3iqca_:

Sequence, based on SEQRES records: (download)

>d3iqca_ a.24.19.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
yanayqayqhnrvsvespakliemlyegilrfssqakrcienediekkiyyinrvtdift
ellnildyekggevavyltglythqikvltqanvendaskidlvlnvarglleawreihs
dela

Sequence, based on observed residues (ATOM records): (download)

>d3iqca_ a.24.19.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
yanayqayqhespakliemlyegilrfssqakrcienediekkiyyinrvtdiftellni
ldyekggevavyltglythqikvltqanvendaskidlvlnvarglleawreihsdela

SCOPe Domain Coordinates for d3iqca_:

Click to download the PDB-style file with coordinates for d3iqca_.
(The format of our PDB-style files is described here.)

Timeline for d3iqca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3iqcb_