| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.19: Flagellar export chaperone FliS [101116] (2 families) ![]() can form closed, open and helix-swapped bundles |
| Family a.24.19.0: automated matches [191633] (1 protein) not a true family |
| Protein automated matches [191166] (3 species) not a true protein |
| Species Helicobacter pylori [TaxId:85962] [189381] (2 PDB entries) |
| Domain d3iqca_: 3iqc A: [178534] automated match to d1vh6b_ |
PDB Entry: 3iqc (more details), 2.7 Å
SCOPe Domain Sequences for d3iqca_:
Sequence, based on SEQRES records: (download)
>d3iqca_ a.24.19.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
yanayqayqhnrvsvespakliemlyegilrfssqakrcienediekkiyyinrvtdift
ellnildyekggevavyltglythqikvltqanvendaskidlvlnvarglleawreihs
dela
>d3iqca_ a.24.19.0 (A:) automated matches {Helicobacter pylori [TaxId: 85962]}
yanayqayqhespakliemlyegilrfssqakrcienediekkiyyinrvtdiftellni
ldyekggevavyltglythqikvltqanvendaskidlvlnvarglleawreihsdela
Timeline for d3iqca_: