SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3iq6e_ (3iq6 E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1987402Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 1987403Family a.24.3.1: Cytochrome b562 [47176] (2 protein domains)
    automatically mapped to Pfam PF07361
  6. 1987414Protein automated matches [190502] (2 species)
    not a true protein
  7. 1987415Species Escherichia coli [TaxId:562] [187450] (37 PDB entries)
  8. 1987517Domain d3iq6e_: 3iq6 E: [178529]
    automated match to d1qq3a_
    complexed with hem, zn

Details for d3iq6e_

PDB Entry: 3iq6 (more details), 2.35 Å

PDB Description: Crystal structure of a tetrameric Zn-bound cytochrome cb562 complex with covalently and non-covalently stabilized interfaces
PDB Compounds: (E:) Soluble cytochrome b562

SCOPe Domain Sequences for d3iq6e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iq6e_ a.24.3.1 (E:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihdalhlanegkvkeaqaaaeqlkctcnachqkyr

SCOPe Domain Coordinates for d3iq6e_:

Click to download the PDB-style file with coordinates for d3iq6e_.
(The format of our PDB-style files is described here.)

Timeline for d3iq6e_: