Lineage for d3iq6a_ (3iq6 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 909860Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 909895Superfamily a.24.3: Cytochromes [47175] (2 families) (S)
    Heme-containing proteins
  5. 909896Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
  6. 909907Protein automated matches [190502] (1 species)
    not a true protein
  7. 909908Species Escherichia coli [TaxId:562] [187450] (24 PDB entries)
  8. 909988Domain d3iq6a_: 3iq6 A: [178525]
    automated match to d1qq3a_
    complexed with hem, zn

Details for d3iq6a_

PDB Entry: 3iq6 (more details), 2.35 Å

PDB Description: crystal structure of a tetrameric zn-bound cytochrome cb562 complex with covalently and non-covalently stabilized interfaces
PDB Compounds: (A:) Soluble cytochrome b562

SCOPe Domain Sequences for d3iq6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iq6a_ a.24.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihdalhlanegkvkeaqaaaeqlkctcnachqkyr

SCOPe Domain Coordinates for d3iq6a_:

Click to download the PDB-style file with coordinates for d3iq6a_.
(The format of our PDB-style files is described here.)

Timeline for d3iq6a_: