Lineage for d3iq5c_ (3iq5 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2312848Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2312849Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
    automatically mapped to Pfam PF07361
  6. 2313062Protein automated matches [190502] (2 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [187450] (24 PDB entries)
  8. 2313082Domain d3iq5c_: 3iq5 C: [178523]
    automated match to d1qq3a_
    complexed with hem

Details for d3iq5c_

PDB Entry: 3iq5 (more details), 2.05 Å

PDB Description: crystal structure of an engineered metal-free tetrameric cytochrome cb562 complex templated by zn-coordination
PDB Compounds: (C:) Soluble cytochrome b562

SCOPe Domain Sequences for d3iq5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iq5c_ a.24.3.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihdalhlanegkvkeaqaaaeqlkctcnachqkyr

SCOPe Domain Coordinates for d3iq5c_:

Click to download the PDB-style file with coordinates for d3iq5c_.
(The format of our PDB-style files is described here.)

Timeline for d3iq5c_: