SCOPe 2.07: Domain d3iq5c_: 3iq5 C:

Lineage for d3iq5c_ (3iq5 C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
   automatically mapped to Pfam PF07361

6. Protein automated matches [190502] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187450] (24 PDB entries)

8. Domain d3iq5c_: 3iq5 C: [178523]
   automated match to d1qq3a_
   complexed with hem

Details for d3iq5c_

PDB Entry: 3iq5, 2.05 Å

PDB Description: crystal structure of an engineered metal-free tetrameric cytochrome cb562 complex templated by zn-coordination

PDB Compounds: (C:) Soluble cytochrome b562

SCOPe Domain Sequences for d3iq5c_:

Sequence; same for both SEQRES and ATOM records:

>d3iq5c_ a.24.3.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihdalhlanegkvkeaqaaaeqlkctcnachqkyr

Timeline for d3iq5c_:

• d3iq5c_ first appeared in SCOPe 2.01
  
• d3iq5c_ appears in SCOPe 2.06
  
• d3iq5c_ appears in the current release, SCOPe 2.08