| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.3: Cytochromes [47175] (3 families) ![]() Heme-containing proteins |
| Family a.24.3.1: Cytochrome b562 [47176] (2 proteins) automatically mapped to Pfam PF07361 |
| Protein automated matches [190502] (2 species) not a true protein |
| Domain d3iq5a_: 3iq5 A: [178521] automated match to d1qq3a_ complexed with hem |
PDB Entry: 3iq5 (more details), 2.05 Å
SCOPe Domain Sequences for d3iq5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iq5a_ a.24.3.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
frhgfwiligqihdalhlanegkvkeaqaaaeqlkctcnachqkyr
Timeline for d3iq5a_: