SCOPe 2.08: Domain d3iptc_: 3ipt C:

Lineage for d3iptc_ (3ipt C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
   automatically mapped to Pfam PF12680
   automatically mapped to Pfam PF02136

6. Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (3 species)

7. Species Pseudomonas putida [TaxId:303] [54437] (61 PDB entries)
   Uniprot P07445

8. Domain d3iptc_: 3ipt C: [178512]
   automated match to d1e3vb_
   complexed with equ

Details for d3iptc_

PDB Entry: 3ipt, 1.63 Å

PDB Description: crystal structure of ketosteroid isomerase y16s/d40n from pseudomonas putida with bound equilenin

PDB Compounds: (C:) steroid delta-isomerase

SCOPe Domain Sequences for d3iptc_:

Sequence, based on SEQRES records:

>d3iptc_ d.17.4.3 (C:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmarsielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws
evnlsv

Sequence, based on observed residues (ATOM records):

>d3iptc_ d.17.4.3 (C:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmarsielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
kvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsevn
lsv

Timeline for d3iptc_:

• d3iptc_ first appeared in SCOPe 2.01
  
• d3iptc_ appears in SCOPe 2.07