Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (31 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins) automatically mapped to Pfam PF12680 automatically mapped to Pfam PF02136 |
Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species) |
Species Pseudomonas putida [TaxId:303] [54437] (46 PDB entries) Uniprot P07445 |
Domain d3iptb_: 3ipt B: [178511] automated match to d1e3vb_ complexed with equ |
PDB Entry: 3ipt (more details), 1.63 Å
SCOPe Domain Sequences for d3iptb_:
Sequence, based on SEQRES records: (download)
>d3iptb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]} nlptaqevqglmarsielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws evnlsv
>d3iptb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]} nlptaqevqglmarsielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl kvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsevn lsv
Timeline for d3iptb_: