Lineage for d3iptb_ (3ipt B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1196747Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1197160Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1197250Family d.17.4.3: Ketosteroid isomerase-like [54434] (2 proteins)
  6. 1197251Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)
  7. 1197307Species Pseudomonas putida [TaxId:303] [54437] (35 PDB entries)
    Uniprot P07445
  8. 1197329Domain d3iptb_: 3ipt B: [178511]
    automated match to d1e3vb_
    complexed with equ

Details for d3iptb_

PDB Entry: 3ipt (more details), 1.63 Å

PDB Description: crystal structure of ketosteroid isomerase y16s/d40n from pseudomonas putida with bound equilenin
PDB Compounds: (B:) steroid delta-isomerase

SCOPe Domain Sequences for d3iptb_:

Sequence, based on SEQRES records: (download)

>d3iptb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmarsielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
gggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayws
evnlsv

Sequence, based on observed residues (ATOM records): (download)

>d3iptb_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
nlptaqevqglmarsielvdvgdieaivqmyaddatvenpfgqppihgreqiaafyrqgl
kvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqaywsevn
lsv

SCOPe Domain Coordinates for d3iptb_:

Click to download the PDB-style file with coordinates for d3iptb_.
(The format of our PDB-style files is described here.)

Timeline for d3iptb_: