![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.54: PTS system fructose IIA component-like [53061] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest |
![]() | Superfamily c.54.1: PTS system fructose IIA component-like [53062] (3 families) ![]() active dimer is formed by strand 5 swapping |
![]() | Family c.54.1.0: automated matches [191356] (1 protein) not a true family |
![]() | Protein automated matches [190395] (4 species) not a true protein |
![]() | Species Enterococcus faecalis [TaxId:1351] [189023] (1 PDB entry) |
![]() | Domain d3iprc_: 3ipr C: [178506] automated match to d1pdoa_ complexed with ca |
PDB Entry: 3ipr (more details), 2.5 Å
SCOPe Domain Sequences for d3iprc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iprc_ c.54.1.0 (C:) automated matches {Enterococcus faecalis [TaxId: 1351]} mlgiviathgalsdgakdaatvimgatenietvnlnsgddvqalggqiktaienvqqgdg vlvmvdllsaspynqavlvinelepalqkkifvvsgtnlpmvleainhqllgtpiaeaaq aivaqgkesvqawdismts
Timeline for d3iprc_: