SCOPe 2.01: Domain d3ioqa_: 3ioq A:

Lineage for d3ioqa_ (3ioq A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein automated matches [190264] (8 species)
   not a true protein

7. Species Carica candamarcensis [TaxId:35926] [189214] (1 PDB entry)

8. Domain d3ioqa_: 3ioq A: [178493]
   automated match to d1khpa_
   complexed with e64, edo, so4

Details for d3ioqa_

PDB Entry: 3ioq, 1.87 Å

PDB Description: crystal structure of the carica candamarcensis cysteine protease cms1ms2 in complex with e-64.

PDB Compounds: (A:) cms1ms2

SCOPe Domain Sequences for d3ioqa_:

Sequence; same for both SEQRES and ATOM records:

>d3ioqa_ d.3.1.1 (A:) automated matches {Carica candamarcensis [TaxId: 35926]}
iptsidwrqkgavtpvrnqggcgscwtfssvaaveginkivtgqllslseqelldcerrs
ygcrggfplyalqyvansgihlrqyypyegvqrqcrasqakgpkvktdgvgrvprnneqa
liqriaiqpvsivveakgrafqnyrggifagpcgtsidhavaavgygndyiliknswgtg
wgeggyirikrgsgnpqgacgvlsdsvfptknr

Timeline for d3ioqa_:

• d3ioqa_ is new in SCOPe 2.01-stable
  
• d3ioqa_ appears in SCOPe 2.02
  
• d3ioqa_ appears in the current release, SCOPe 2.08