Lineage for d3ioqa_ (3ioq A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2926591Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 2926957Protein automated matches [190264] (12 species)
    not a true protein
  7. 2926963Species Carica candamarcensis [TaxId:35926] [189214] (1 PDB entry)
  8. 2926964Domain d3ioqa_: 3ioq A: [178493]
    automated match to d1khpa_
    complexed with e64, edo, so4

Details for d3ioqa_

PDB Entry: 3ioq (more details), 1.87 Å

PDB Description: crystal structure of the carica candamarcensis cysteine protease cms1ms2 in complex with e-64.
PDB Compounds: (A:) cms1ms2

SCOPe Domain Sequences for d3ioqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ioqa_ d.3.1.1 (A:) automated matches {Carica candamarcensis [TaxId: 35926]}
iptsidwrqkgavtpvrnqggcgscwtfssvaaveginkivtgqllslseqelldcerrs
ygcrggfplyalqyvansgihlrqyypyegvqrqcrasqakgpkvktdgvgrvprnneqa
liqriaiqpvsivveakgrafqnyrggifagpcgtsidhavaavgygndyiliknswgtg
wgeggyirikrgsgnpqgacgvlsdsvfptknr

SCOPe Domain Coordinates for d3ioqa_:

Click to download the PDB-style file with coordinates for d3ioqa_.
(The format of our PDB-style files is described here.)

Timeline for d3ioqa_: