Lineage for d3iomb_ (3iom B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2887827Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2887828Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2888641Protein automated matches [190142] (21 species)
    not a true protein
  7. 2888735Species Mycobacterium tuberculosis [TaxId:1773] [189596] (2 PDB entries)
  8. 2888739Domain d3iomb_: 3iom B: [178492]
    automated match to d1i80a_
    complexed with gng, so4

Details for d3iomb_

PDB Entry: 3iom (more details), 2.14 Å

PDB Description: Crystal structure of Purine Nucleoside Phosphorylase from Mycobacterium tuberculosis in complex with 2'-Deoxyguanosine
PDB Compounds: (B:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d3iomb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iomb_ c.56.2.1 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dpdelarraaqviadrtgigehdvavvlgsgwlpavaalgspttvlpqaelpgfvpptaa
ghagellsvpigahrvlvlagrihayeghdlryvvhpvraaraagaqimvltnaagglra
dlqvgqpvlisdhlnltarsplvggefvdltdaysprlrelarqsdpqlaegvyaglpgp
hyetpaeirmlqtlgadlvgmstvhetiaaraagaevlgvslvtnlaagitgeplshaev
laagaasatrmgalladviarf

SCOPe Domain Coordinates for d3iomb_:

Click to download the PDB-style file with coordinates for d3iomb_.
(The format of our PDB-style files is described here.)

Timeline for d3iomb_: