Lineage for d3iojb1 (3ioj B:64-346)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2505843Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2505844Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2506312Family c.68.1.9: alpha-1,3-galactosyltransferase-like [64131] (4 proteins)
    automatically mapped to Pfam PF03414
  6. 2506365Protein Glycosyltransferase A catalytic domain [75276] (1 species)
    involved in blood group antigen biosynthesis
  7. 2506366Species Human (Homo sapiens) [TaxId:9606] [75277] (59 PDB entries)
    Uniprot P16442 64-345
  8. 2506416Domain d3iojb1: 3ioj B:64-346 [178490]
    Other proteins in same PDB: d3ioja2, d3iojb2
    automated match to d1lz0a_
    complexed with gol, mn, so4, udp; mutant

Details for d3iojb1

PDB Entry: 3ioj (more details), 1.65 Å

PDB Description: crystal structure of the fucosylgalactoside alpha n- acetylgalactosaminyltransferase (gta, cisab mutant l266g, g268a) in complex with udp
PDB Compounds: (B:) Histo-blood group ABO system transferase

SCOPe Domain Sequences for d3iojb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iojb1 c.68.1.9 (B:64-346) Glycosyltransferase A catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
vslprmvypqpkvltpcrkdvlvvtpwlapivwegtfnidilneqfrlqnttigltvfai
kkyvaflklfletaekhfmvghrvhyyvftdqpaavprvtlgtgrqlsvlevraykrwqd
vsmrrmemisdfcerrflsevdylvcvdvdmefrdhvgveiltplfgtlhpgfygssrea
ftyerrpqsqayipkdegdfyyggaffggsvqevqrltrachqammvdqangieavwhde
shlnkyllrhkptkvlspeylwdqqllgwpavlrklrftavpk

SCOPe Domain Coordinates for d3iojb1:

Click to download the PDB-style file with coordinates for d3iojb1.
(The format of our PDB-style files is described here.)

Timeline for d3iojb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3iojb2