Lineage for d3iofa_ (3iof A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2602907Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2602908Protein Zn metallo-beta-lactamase [56283] (12 species)
  7. 2602909Species Aeromonas hydrophila, CphA [TaxId:644] [118144] (11 PDB entries)
    Uniprot P26918 28-252
  8. 2602911Domain d3iofa_: 3iof A: [178485]
    automated match to d1x8ha_
    complexed with gol, ifs, so4, zn; mutant

Details for d3iofa_

PDB Entry: 3iof (more details), 1.44 Å

PDB Description: Crystal structure of CphA N220G mutant with inhibitor 10a
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d3iofa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iofa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]}
agmsltqvsgpvyvvednyyvqensmvyfgakgvtvvgatwtpdtarelhklikrvsrkp
vlevintnyhtdraggnaywksigakvvstrqtrdlmksdwaeivaftrkglpeypdlpl
vlpnvvhdgdftlqegkvrafyagpahtpdgifvyfpdeqvlyggcilkeklgnlsfadv
kaypqtlerlkamklpiktvigghdsplhgpelidhyealikaapqs

SCOPe Domain Coordinates for d3iofa_:

Click to download the PDB-style file with coordinates for d3iofa_.
(The format of our PDB-style files is described here.)

Timeline for d3iofa_: