Lineage for d3ioea_ (3ioe A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118897Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2118898Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2119405Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins)
    contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
    automatically mapped to Pfam PF02569
  6. 2119406Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (5 species)
  7. 2119410Species Mycobacterium tuberculosis [TaxId:1773] [89615] (48 PDB entries)
  8. 2119464Domain d3ioea_: 3ioe A: [178483]
    automated match to d1n2ga_
    complexed with a7d, eoh, gol, so4

Details for d3ioea_

PDB Entry: 3ioe (more details), 1.95 Å

PDB Description: crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.95 ang resolution in complex with 5'-deoxy-5'-((r)-3, 4-dihydroxybutylthio)-adenosine
PDB Compounds: (A:) Pantothenate synthetase

SCOPe Domain Sequences for d3ioea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ioea_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis [TaxId: 1773]}
pafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsvvv
vsifvnpmqfgaggdldayprtpdddlaqlraegveiaftpttaamypdglrttvqpgpl
aaeleggprpthfagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvavvg
vptvreadglamssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravldaap
gvavdylelrdiglgpmplngsgrllvaarlgttrlldniaieigt

SCOPe Domain Coordinates for d3ioea_:

Click to download the PDB-style file with coordinates for d3ioea_.
(The format of our PDB-style files is described here.)

Timeline for d3ioea_: