Lineage for d3ioca_ (3ioc A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105862Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 protein domains)
    contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
    automatically mapped to Pfam PF02569
  6. 2105863Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (5 species)
  7. 2105867Species Mycobacterium tuberculosis [TaxId:1773] [89615] (48 PDB entries)
  8. 2105953Domain d3ioca_: 3ioc A: [178479]
    automated match to d1n2ga_
    complexed with a5d, gol

Details for d3ioca_

PDB Entry: 3ioc (more details), 2.5 Å

PDB Description: crystal structure of mycobacterium tuberculosis pantothenate synthetase at 2.50 ang resolution in complex with 5'-deoxy-5'- (benzyldisulfanyl)-adenosine
PDB Compounds: (A:) Pantothenate synthetase

SCOPe Domain Sequences for d3ioca_:

Sequence, based on SEQRES records: (download)

>d3ioca_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis [TaxId: 1773]}
pafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsvvv
vsifvnpmqfgaggdldayprtpdddlaqlraegveiaftpttaamypdglrttvqpgpl
aaeleggprpthfagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvavvg
vptvreadglamssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravldaap
gvavdylelrdiglgpmplngsgrllvaarlgttrlldniaieig

Sequence, based on observed residues (ATOM records): (download)

>d3ioca_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis [TaxId: 1773]}
pafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsvvv
vsifvnpmqtpdddlaqlraegveiaftpttaamypdglrttvqpgplaaeleggprpth
fagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvavvgvptvreadglam
ssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravldaapgvavdylelrdi
glgpmplngsgrllvaarlgttrlldniaieig

SCOPe Domain Coordinates for d3ioca_:

Click to download the PDB-style file with coordinates for d3ioca_.
(The format of our PDB-style files is described here.)

Timeline for d3ioca_: