| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
| Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins) contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family automatically mapped to Pfam PF02569 |
| Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (5 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [89615] (48 PDB entries) |
| Domain d3ioba_: 3iob A: [178477] automated match to d1n2ga_ complexed with a4d, eoh, gol, so4 |
PDB Entry: 3iob (more details), 1.8 Å
SCOPe Domain Sequences for d3ioba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ioba_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis [TaxId: 1773]}
ipafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsvv
vvsifvnpmqfgaggdldayprtpdddlaqlraegveiaftpttaamypdglrttvqpgp
laaeleggprpthfagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvavv
gvptvreadglamssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravldaa
pgvavdylelrdiglgpmplngsgrllvaarlgttrlldniaieigt
Timeline for d3ioba_: