Lineage for d3inzd_ (3inz D:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2057136Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2057137Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2057429Family b.38.1.2: Pleiotropic translational regulator Hfq [74939] (2 proteins)
    forms homohexameric ring structures
  6. 2057430Protein Pleiotropic translational regulator Hfq [74940] (3 species)
  7. 2057438Species Pseudomonas aeruginosa [TaxId:287] [141293] (11 PDB entries)
    Uniprot Q9HUM0 6-71
  8. 2057442Domain d3inzd_: 3inz D: [178471]
    automated match to d1u1sa1
    complexed with cd, cl, na

Details for d3inzd_

PDB Entry: 3inz (more details), 1.7 Å

PDB Description: h57t hfq from pseudomonas aeruginosa
PDB Compounds: (D:) Protein hfq

SCOPe Domain Sequences for d3inzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3inzd_ b.38.1.2 (D:) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]}
hslqdpylntlrkervpvsiylvngiklqgqiesfdqfvillkntvsqmvyktaistvvp
srpvrlp

SCOPe Domain Coordinates for d3inzd_:

Click to download the PDB-style file with coordinates for d3inzd_.
(The format of our PDB-style files is described here.)

Timeline for d3inzd_: