SCOPe 2.07: Domain d3inqa_: 3inq A:

Lineage for d3inqa_ (3inq A:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein automated matches [190236] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188722] (88 PDB entries)

8. Domain d3inqa_: 3inq A: [178463]
   automated match to d1g5ja_
   complexed with cl, edo, x0j

Details for d3inqa_

PDB Entry: 3inq, 2 Å

PDB Description: crystal structure of bcl-xl in complex with w1191542

PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d3inqa_:

Sequence; same for both SEQRES and ATOM records:

>d3inqa_ f.1.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitpgt
ayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndhl
epwiqenggwdtfvelyg

Timeline for d3inqa_:

• d3inqa_ first appeared in SCOPe 2.01
  
• d3inqa_ appears in SCOPe 2.06
  
• d3inqa_ appears in the current release, SCOPe 2.08