SCOPe 2.02: Domain d3inmc_: 3inm C:

Lineage for d3inmc_ (3inm C:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families)
   the constituent families form similar dimers

5. Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 proteins)
   the active site is between the two identical subunits

6. Protein automated matches [190072] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189131] (3 PDB entries)

8. Domain d3inmc_: 3inm C: [178462]
   automated match to d1t09a_
   protein/RNA complex; complexed with akg, ca, gol, na, ndp; mutant

Details for d3inmc_

PDB Entry: 3inm, 2.1 Å

PDB Description: crystal structure of human cytosolic nadp(+)-dependent isocitrate dehydrogenase r132h mutant in complex with nadph, alpha-ketoglutarate and calcium(2+)

PDB Compounds: (C:) isocitrate dehydrogenase [nadp] cytoplasmic

SCOPe Domain Sequences for d3inmc_:

Sequence; same for both SEQRES and ATOM records:

>d3inmc_ c.77.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kisggsvvemqgdemtriiwelikeklifpyveldlhsydlgienrdatndqvtkdaaea
ikkhnvgvkcatitpdekrveefklkqmwkspngtirnilggtvfreaiickniprlvsg
wvkpiiighhaygdqyratdfvvpgpgkveitytpsdgtqkvtylvhnfeegggvamgmy
nqdksiedfahssfqmalskgwplylstkntilkkydgrfkdifqeiydkqyksqfeaqk
iwyehrliddmvaqamkseggfiwacknydgdvqsdsvaqgygslgmmtsvlvcpdgktv
eaeaahgtvtrhyrmyqkgqetstnpiasifawtrglahrakldnnkelaffanaleevs
ietieagfmtkdlaacikglpnvqrsdylntfefmdklgenlkikla

Timeline for d3inmc_:

• d3inmc_ first appeared in SCOPe 2.01
  
• d3inmc_ appears in SCOPe 2.03
  
• d3inmc_ appears in the current release, SCOPe 2.08