Lineage for d3inlc_ (3inl C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2140673Family c.82.1.1: ALDH-like [53721] (6 protein domains)
  6. 2140678Protein Aldehyde reductase (dehydrogenase), ALDH [53722] (9 species)
  7. 2140702Species Human (Homo sapiens), mitochondrial [TaxId:9606] [53726] (27 PDB entries)
    Uniprot P05091
  8. 2140729Domain d3inlc_: 3inl C: [178454]
    automated match to d1o01c_
    complexed with bxb, edo, na

Details for d3inlc_

PDB Entry: 3inl (more details), 1.86 Å

PDB Description: human mitochondrial aldehyde dehydrogenase asian variant, aldh2*2, complexed with agonist alda-1
PDB Compounds: (C:) aldehyde dehydrogenase, mitochondrial

SCOPe Domain Sequences for d3inlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3inlc_ c.82.1.1 (C:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
avpapnqqpevfcnqifinnewhdavsrktfptvnpstgevicqvaegdkedvdkavkaa
raafqlgspwrrmdashrgrllnrladlierdrtylaaletldngkpyvisylvdldmvl
kclryyagwadkyhgktipidgdffsytrhepvgvcgqiipwnfpllmqawklgpalatg
nvvvmkvaeqtpltalyvanlikeagfppgvvnivpgfgptagaaiashedvdkvaftgs
teigrviqvaagssnlkrvtlelggkspniimsdadmdwaveqahfalffnqgqcscags
rtfvqediydefversvaraksrvvgnpfdskteqgpqvdetqfkkilgyintgkqegak
llcgggiaadrgyfiqptvfgdvqdgmtiakeeifgpvmqilkfktieevvgrannstyg
laaavftkdldkanylsqalqagtvwvncydvfgaqspfggykmsgsgrelgeyglqayt
kvktvtvkvpqkns

SCOPe Domain Coordinates for d3inlc_:

Click to download the PDB-style file with coordinates for d3inlc_.
(The format of our PDB-style files is described here.)

Timeline for d3inlc_: