Lineage for d1petc_ (1pet C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714980Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
    core: 4 helices; bundle
  4. 2714981Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) (S)
    homotetramer
  5. 2714982Family a.53.1.1: p53 tetramerization domain [47720] (1 protein)
  6. 2714983Protein p53 tetramerization domain [47721] (1 species)
  7. 2714984Species Human (Homo sapiens) [TaxId:9606] [47722] (18 PDB entries)
  8. 2715037Domain d1petc_: 1pet C: [17845]

Details for d1petc_

PDB Entry: 1pet (more details)

PDB Description: nmr solution structure of the tetrameric minimum transforming domain of p53
PDB Compounds: (C:) tumor suppressor p53

SCOPe Domain Sequences for d1petc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1petc_ a.53.1.1 (C:) p53 tetramerization domain {Human (Homo sapiens) [TaxId: 9606]}
geyftlqirgrerfemfrelnealelkdaqa

SCOPe Domain Coordinates for d1petc_:

Click to download the PDB-style file with coordinates for d1petc_.
(The format of our PDB-style files is described here.)

Timeline for d1petc_: