Lineage for d3in0b_ (3in0 B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1527467Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1527468Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1527469Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1527547Protein Azurin [49530] (6 species)
  7. 1527578Species Pseudomonas aeruginosa [TaxId:287] [49533] (86 PDB entries)
    Uniprot P00282
  8. 1527807Domain d3in0b_: 3in0 B: [178431]
    automated match to d1azna_
    complexed with cu

Details for d3in0b_

PDB Entry: 3in0 (more details), 2.35 Å

PDB Description: crystal structure of the f114p/m121q variant of pseudomonas aeruginosa azurin in the cu(ii) state
PDB Compounds: (B:) Azurin

SCOPe Domain Sequences for d3in0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3in0b_ b.6.1.1 (B:) Azurin {Pseudomonas aeruginosa [TaxId: 287]}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctppghsal
qkgtltlk

SCOPe Domain Coordinates for d3in0b_:

Click to download the PDB-style file with coordinates for d3in0b_.
(The format of our PDB-style files is described here.)

Timeline for d3in0b_: