Lineage for d3imya_ (3imy A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009325Protein Thyroid hormone receptor beta (TR-beta) [48530] (1 species)
  7. 2009326Species Human (Homo sapiens) [TaxId:9606] [48531] (16 PDB entries)
    Uniprot P10828 202-460
  8. 2009338Domain d3imya_: 3imy A: [178429]
    automated match to d1nq0a_
    complexed with b72

Details for d3imya_

PDB Entry: 3imy (more details), 2.55 Å

PDB Description: structure of tr-beta bound to selective thyromimetic gc-1
PDB Compounds: (A:) Thyroid hormone receptor beta

SCOPe Domain Sequences for d3imya_:

Sequence, based on SEQRES records: (download)

>d3imya_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]}
meelqksighkpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqapivnape
ggkvdleafshftkiitpaitrvvdfakklpmfcelpcedqiillkgccmeimslraavr
ydpesetltlngemavtrgqlkngglgvvsdaifdlgmslssfnlddtevallqavllms
sdrpglacveriekyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrfl
hmkvecptelfpplflevfed

Sequence, based on observed residues (ATOM records): (download)

>d3imya_ a.123.1.1 (A:) Thyroid hormone receptor beta (TR-beta) {Human (Homo sapiens) [TaxId: 9606]}
meelqksighkpeptdeeweliktvteahvatnaqgshwkqkrkflpedigqkvdleafs
hftkiitpaitrvvdfakklpmfcelpcedqiillkgccmeimslraavrydpesetltl
ngemavtrgqlkngglgvvsdaifdlgmslssfnlddtevallqavllmssdrpglacve
riekyqdsfllafehyinyrkhhvthfwpkllmkvtdlrmigachasrflhmkvecptel
fpplflevfed

SCOPe Domain Coordinates for d3imya_:

Click to download the PDB-style file with coordinates for d3imya_.
(The format of our PDB-style files is described here.)

Timeline for d3imya_: