| Class b: All beta proteins [48724] (174 folds) |
| Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) ![]() |
| Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins) |
| Protein Transthyretin (synonym: prealbumin) [49474] (5 species) sandwich; 8 strands in 2 sheets |
| Species Human (Homo sapiens) [TaxId:9606] [49475] (141 PDB entries) Uniprot P02766 31-143 |
| Domain d3imrb_: 3imr B: [178418] automated match to d1eta1_ complexed with iw1 |
PDB Entry: 3imr (more details), 1.7 Å
SCOPe Domain Sequences for d3imrb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3imrb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
Timeline for d3imrb_: