Lineage for d3imqc_ (3imq C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719091Fold a.79: NusB-like [48012] (1 superfamily)
    6 helices: bundle; one central helix is surrounded by 5 others
  4. 2719092Superfamily a.79.1: NusB-like [48013] (4 families) (S)
  5. 2719093Family a.79.1.1: Antitermination factor NusB [48014] (2 proteins)
    automatically mapped to Pfam PF01029
  6. 2719109Protein automated matches [190997] (1 species)
    not a true protein
  7. 2719110Species Escherichia coli K-12 [TaxId:83333] [188726] (3 PDB entries)
  8. 2719114Domain d3imqc_: 3imq C: [178416]
    automated match to d1ey1a_
    protein/RNA complex; complexed with k

Details for d3imqc_

PDB Entry: 3imq (more details), 2.5 Å

PDB Description: crystal structure of the nusb101-s10(delta loop) complex
PDB Compounds: (C:) N utilization substance protein B

SCOPe Domain Sequences for d3imqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3imqc_ a.79.1.1 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
paarrrarecavqalyswqlsqndiadveyqflaeqdvkdvdvlyfrellagvatntayl
dglmkpylsrlleelgqvekavlrialyelskrsdvpykvaineaielaksfgaenshkf
vngvldkaapvirpnkk

SCOPe Domain Coordinates for d3imqc_:

Click to download the PDB-style file with coordinates for d3imqc_.
(The format of our PDB-style files is described here.)

Timeline for d3imqc_: