SCOPe 2.08: Domain d3imqc_: 3imq C:

Lineage for d3imqc_ (3imq C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.79: NusB-like [48012] (1 superfamily)
   6 helices: bundle; one central helix is surrounded by 5 others

4. Superfamily a.79.1: NusB-like [48013] (4 families)

5. Family a.79.1.1: Antitermination factor NusB [48014] (2 proteins)
   automatically mapped to Pfam PF01029

6. Protein automated matches [190997] (1 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [188726] (3 PDB entries)

8. Domain d3imqc_: 3imq C: [178416]
   automated match to d1ey1a_
   protein/RNA complex; complexed with k

Details for d3imqc_

PDB Entry: 3imq, 2.5 Å

PDB Description: crystal structure of the nusb101-s10(delta loop) complex

PDB Compounds: (C:) N utilization substance protein B

SCOPe Domain Sequences for d3imqc_:

Sequence; same for both SEQRES and ATOM records:

>d3imqc_ a.79.1.1 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
paarrrarecavqalyswqlsqndiadveyqflaeqdvkdvdvlyfrellagvatntayl
dglmkpylsrlleelgqvekavlrialyelskrsdvpykvaineaielaksfgaenshkf
vngvldkaapvirpnkk

Timeline for d3imqc_:

• d3imqc_ first appeared in SCOPe 2.01
  
• d3imqc_ appears in SCOPe 2.07