SCOPe 2.05: Domain d3imqa_: 3imq A:

Lineage for d3imqa_ (3imq A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.79: NusB-like [48012] (1 superfamily)
   6 helices: bundle; one central helix is surrounded by 5 others

4. Superfamily a.79.1: NusB-like [48013] (3 families)

5. Family a.79.1.1: Antitermination factor NusB [48014] (2 proteins)
   automatically mapped to Pfam PF01029

6. Protein automated matches [190997] (1 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [188726] (3 PDB entries)

8. Domain d3imqa_: 3imq A: [178414]
   automated match to d1ey1a_
   protein/RNA complex; complexed with k

Details for d3imqa_

PDB Entry: 3imq, 2.5 Å

PDB Description: crystal structure of the nusb101-s10(delta loop) complex

PDB Compounds: (A:) N utilization substance protein B

SCOPe Domain Sequences for d3imqa_:

Sequence; same for both SEQRES and ATOM records:

>d3imqa_ a.79.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
paarrrarecavqalyswqlsqndiadveyqflaeqdvkdvdvlyfrellagvatntayl
dglmkpylsrlleelgqvekavlrialyelskrsdvpykvaineaielaksfgaenshkf
vngvldkaapvirpnkk

Timeline for d3imqa_:

• d3imqa_ first appeared in SCOPe 2.01
  
• d3imqa_ appears in SCOPe 2.04
  
• d3imqa_ appears in SCOPe 2.06
  
• d3imqa_ appears in the current release, SCOPe 2.08