Lineage for d1salc_ (1sal C:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4111Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
  4. 4112Superfamily a.53.1: p53 tetramerization domain [47719] (1 family) (S)
  5. 4113Family a.53.1.1: p53 tetramerization domain [47720] (1 protein)
  6. 4114Protein p53 tetramerization domain [47721] (1 species)
  7. 4115Species Human (Homo sapiens) [TaxId:9606] [47722] (17 PDB entries)
  8. 4144Domain d1salc_: 1sal C: [17841]

Details for d1salc_

PDB Entry: 1sal (more details)

PDB Description: high resolution solution nmr structure of the oligomerization domain of p53 by multi-dimensional nmr (sad structures)

SCOP Domain Sequences for d1salc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1salc_ a.53.1.1 (C:) p53 tetramerization domain {Human (Homo sapiens)}
kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg

SCOP Domain Coordinates for d1salc_:

Click to download the PDB-style file with coordinates for d1salc_.
(The format of our PDB-style files is described here.)

Timeline for d1salc_: