Lineage for d1salb_ (1sal B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737237Fold a.53: p53 tetramerization domain [47718] (1 superfamily)
    core: 4 helices; bundle
  4. 1737238Superfamily a.53.1: p53 tetramerization domain [47719] (2 families) (S)
    homotetramer
  5. 1737239Family a.53.1.1: p53 tetramerization domain [47720] (1 protein)
  6. 1737240Protein p53 tetramerization domain [47721] (1 species)
  7. 1737241Species Human (Homo sapiens) [TaxId:9606] [47722] (14 PDB entries)
  8. 1737257Domain d1salb_: 1sal B: [17840]

Details for d1salb_

PDB Entry: 1sal (more details)

PDB Description: high resolution solution nmr structure of the oligomerization domain of p53 by multi-dimensional nmr (sad structures)
PDB Compounds: (B:) tumor suppressor p53

SCOPe Domain Sequences for d1salb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1salb_ a.53.1.1 (B:) p53 tetramerization domain {Human (Homo sapiens) [TaxId: 9606]}
kkkpldgeyftlqirgrerfemfrelnealelkdaqagkepg

SCOPe Domain Coordinates for d1salb_:

Click to download the PDB-style file with coordinates for d1salb_.
(The format of our PDB-style files is described here.)

Timeline for d1salb_: