SCOPe 2.06: Domain d3imac_: 3ima C:

Lineage for d3imac_ (3ima C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Papain [54005] (1 species)

7. Species Papaya (Carica papaya) [TaxId:3649] [54006] (23 PDB entries)

8. Domain d3imac_: 3ima C: [178398]
   Other proteins in same PDB: d3imab_, d3imad_
   automated match to d1khpa_
   complexed with act

Details for d3imac_

PDB Entry: 3ima, 2.03 Å

PDB Description: complex structure of tarocystatin and papain

PDB Compounds: (C:) papain

SCOPe Domain Sequences for d3imac_:

Sequence; same for both SEQRES and ATOM records:

>d3imac_ d.3.1.1 (C:) Papain {Papaya (Carica papaya) [TaxId: 3649]}
ipeyvdwrqkgavtpvknqgscgscwafsavvtiegiikirtgnlneyseqelldcdrrs
ygcnggypwsalqlvaqygihyrntypyegvqrycrsrekgpyaaktdgvrqvqpynega
llysianqpvsvvleaagkdfqlyrggifvgpcgnkvdhavaavgygpnyiliknswgtg
wgengyirikrgtgnsygvcglytssfypvkn

Timeline for d3imac_:

• d3imac_ first appeared in SCOPe 2.01
  
• d3imac_ appears in SCOPe 2.05
  
• d3imac_ appears in SCOPe 2.07
  
• d3imac_ appears in the current release, SCOPe 2.08