Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (7 families) has a additional strand at the N-terminus |
Family d.17.1.0: automated matches [191407] (1 protein) not a true family |
Protein automated matches [190558] (10 species) not a true protein |
Species Colocasia esculenta [TaxId:4460] [189213] (1 PDB entry) |
Domain d3imab_: 3ima B: [178397] Other proteins in same PDB: d3imaa_, d3imac_ automated match to d1eqka_ complexed with act |
PDB Entry: 3ima (more details), 2.03 Å
SCOPe Domain Sequences for d3imab_:
Sequence, based on SEQRES records: (download)
>d3imab_ d.17.1.0 (B:) automated matches {Colocasia esculenta [TaxId: 4460]} almggivdvegaqnsaeveelarfavdehnkkenallqfsrlvkakqqvvsgimhhltve vieggkkkvyeakvwvqawlnskklhefsp
>d3imab_ d.17.1.0 (B:) automated matches {Colocasia esculenta [TaxId: 4460]} almggivdsaeveelarfavdehnkkenallqfsrlvkakqqvvsgimhhltvevieggk kkvyeakvwvqawlnskklhefsp
Timeline for d3imab_: