SCOPe 2.05: Domain d3imab_: 3ima B:

Lineage for d3imab_ (3ima B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.0: automated matches [191407] (1 protein)
   not a true family

6. Protein automated matches [190558] (10 species)
   not a true protein

7. Species Colocasia esculenta [TaxId:4460] [189213] (1 PDB entry)

8. Domain d3imab_: 3ima B: [178397]
   Other proteins in same PDB: d3imaa_, d3imac_
   automated match to d1eqka_
   complexed with act

Details for d3imab_

PDB Entry: 3ima, 2.03 Å

PDB Description: complex structure of tarocystatin and papain

PDB Compounds: (B:) Cysteine proteinase inhibitor

SCOPe Domain Sequences for d3imab_:

Sequence, based on SEQRES records:

>d3imab_ d.17.1.0 (B:) automated matches {Colocasia esculenta [TaxId: 4460]}
almggivdvegaqnsaeveelarfavdehnkkenallqfsrlvkakqqvvsgimhhltve
vieggkkkvyeakvwvqawlnskklhefsp

Sequence, based on observed residues (ATOM records):

>d3imab_ d.17.1.0 (B:) automated matches {Colocasia esculenta [TaxId: 4460]}
almggivdsaeveelarfavdehnkkenallqfsrlvkakqqvvsgimhhltvevieggk
kkvyeakvwvqawlnskklhefsp

Timeline for d3imab_:

• d3imab_ first appeared in SCOPe 2.01
  
• d3imab_ appears in SCOPe 2.04
  
• d3imab_ appears in SCOPe 2.06
  
• d3imab_ appears in the current release, SCOPe 2.08