SCOPe 2.02: Domain d3im4b_: 3im4 B:

Lineage for d3im4b_ (3im4 B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
   4 helices; bundle, closed, right-handed twist

4. Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (1 family)
   dimer of identical alpha-hairpin motifs

5. Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)

6. Protein cAMP-dependent protein kinase type I-alpha regulatory subunit [140510] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [140511] (3 PDB entries)
   Uniprot P00514 12-61

8. Domain d3im4b_: 3im4 B: [178395]
   automated match to d2ezwa1
   complexed with zn

Details for d3im4b_

PDB Entry: 3im4, 2.29 Å

PDB Description: crystal structure of camp-dependent protein kinase a regulatory subunit i alpha in complex with dual-specific a-kinase anchoring protein 2

PDB Compounds: (B:) cAMP-dependent protein kinase type I-alpha regulatory subunit

SCOPe Domain Sequences for d3im4b_:

Sequence; same for both SEQRES and ATOM records:

>d3im4b_ a.31.1.1 (B:) cAMP-dependent protein kinase type I-alpha regulatory subunit {Cow (Bos taurus) [TaxId: 9913]}
slrecelyvqkhniqallkdsivqlctarperpmaflreyfeklekeea

Timeline for d3im4b_:

• d3im4b_ first appeared in SCOPe 2.01
  
• d3im4b_ appears in SCOPe 2.03
  
• d3im4b_ appears in the current release, SCOPe 2.08