Lineage for d3im4b_ (3im4 B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 913472Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 913473Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (1 family) (S)
    dimer of identical alpha-hairpin motifs
  5. 913474Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins)
  6. 913475Protein cAMP-dependent protein kinase type I-alpha regulatory subunit [140510] (1 species)
  7. 913476Species Cow (Bos taurus) [TaxId:9913] [140511] (3 PDB entries)
    Uniprot P00514 12-61
  8. 913479Domain d3im4b_: 3im4 B: [178395]
    automated match to d2ezwa1
    complexed with zn

Details for d3im4b_

PDB Entry: 3im4 (more details), 2.29 Å

PDB Description: crystal structure of camp-dependent protein kinase a regulatory subunit i alpha in complex with dual-specific a-kinase anchoring protein 2
PDB Compounds: (B:) cAMP-dependent protein kinase type I-alpha regulatory subunit

SCOPe Domain Sequences for d3im4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3im4b_ a.31.1.1 (B:) cAMP-dependent protein kinase type I-alpha regulatory subunit {Cow (Bos taurus) [TaxId: 9913]}
slrecelyvqkhniqallkdsivqlctarperpmaflreyfeklekeea

SCOPe Domain Coordinates for d3im4b_:

Click to download the PDB-style file with coordinates for d3im4b_.
(The format of our PDB-style files is described here.)

Timeline for d3im4b_: