Class a: All alpha proteins [46456] (289 folds) |
Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily) 4 helices; bundle, closed, right-handed twist |
Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) dimer of identical alpha-hairpin motifs |
Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 proteins) |
Protein cAMP-dependent protein kinase type I-alpha regulatory subunit [140510] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [140511] (3 PDB entries) Uniprot P00514 12-61 |
Domain d3im3a_: 3im3 A: [178393] automated match to d2ezwa1 complexed with fmt |
PDB Entry: 3im3 (more details), 2 Å
SCOPe Domain Sequences for d3im3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3im3a_ a.31.1.1 (A:) cAMP-dependent protein kinase type I-alpha regulatory subunit {Cow (Bos taurus) [TaxId: 9913]} slrecelyvqkhniqallkdsivqlctarperpmaflreyfeklekeeak
Timeline for d3im3a_: