Lineage for d3im3a_ (3im3 A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993555Fold a.31: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47390] (1 superfamily)
    4 helices; bundle, closed, right-handed twist
  4. 1993556Superfamily a.31.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47391] (2 families) (S)
    dimer of identical alpha-hairpin motifs
  5. 1993557Family a.31.1.1: Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit [47392] (3 protein domains)
  6. 1993558Protein cAMP-dependent protein kinase type I-alpha regulatory subunit [140510] (1 species)
  7. 1993559Species Cow (Bos taurus) [TaxId:9913] [140511] (3 PDB entries)
    Uniprot P00514 12-61
  8. 1993560Domain d3im3a_: 3im3 A: [178393]
    automated match to d2ezwa1
    complexed with fmt

Details for d3im3a_

PDB Entry: 3im3 (more details), 2 Å

PDB Description: Crystal structure of PKA RI alpha dimerization/docking domain
PDB Compounds: (A:) cAMP-dependent protein kinase type I-alpha regulatory subunit

SCOPe Domain Sequences for d3im3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3im3a_ a.31.1.1 (A:) cAMP-dependent protein kinase type I-alpha regulatory subunit {Cow (Bos taurus) [TaxId: 9913]}
slrecelyvqkhniqallkdsivqlctarperpmaflreyfeklekeeak

SCOPe Domain Coordinates for d3im3a_:

Click to download the PDB-style file with coordinates for d3im3a_.
(The format of our PDB-style files is described here.)

Timeline for d3im3a_: