Lineage for d3ilza_ (3ilz A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1747085Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1747086Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1747087Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1747898Protein Thyroid hormone receptor alpha1 (TR-alpha1) [48532] (1 species)
  7. 1747899Species Human (Homo sapiens) [TaxId:9606] [88962] (5 PDB entries)
  8. 1747900Domain d3ilza_: 3ilz A: [178392]
    automated match to d1nava_
    complexed with b72

Details for d3ilza_

PDB Entry: 3ilz (more details), 1.85 Å

PDB Description: Structure of TR-alfa bound to selective thyromimetic GC-1 in P212121 space group
PDB Compounds: (A:) Thyroid hormone receptor, alpha isoform 1 variant

SCOPe Domain Sequences for d3ilza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ilza_ a.123.1.1 (A:) Thyroid hormone receptor alpha1 (TR-alpha1) {Human (Homo sapiens) [TaxId: 9606]}
gshmeemirslqqrpeptpeewdlihiateahrstnaqgshwkqrrkflpddigqspivs
mpdgdkvdleafseftkiitpaitrvvdfakklpmfselpcedqiillkgccmeimslra
avrydpesdtltlsgemavkreqlkngglgvvsdaifelgkslsafnlddtevallqavl
lmstdrsgllcvdkieksqeayllafehyvnhrkhniphfwpkllmkvtdlrmigachas
rflhmkvecptelfpplflevfedqev

SCOPe Domain Coordinates for d3ilza_:

Click to download the PDB-style file with coordinates for d3ilza_.
(The format of our PDB-style files is described here.)

Timeline for d3ilza_: