Lineage for d3ilza1 (3ilz A:148-410)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2729527Protein Thyroid hormone receptor alpha1 (TR-alpha1) [48532] (1 species)
  7. 2729528Species Human (Homo sapiens) [TaxId:9606] [88962] (5 PDB entries)
  8. 2729529Domain d3ilza1: 3ilz A:148-410 [178392]
    Other proteins in same PDB: d3ilza2
    automated match to d1nava_
    complexed with b72

Details for d3ilza1

PDB Entry: 3ilz (more details), 1.85 Å

PDB Description: Structure of TR-alfa bound to selective thyromimetic GC-1 in P212121 space group
PDB Compounds: (A:) Thyroid hormone receptor, alpha isoform 1 variant

SCOPe Domain Sequences for d3ilza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ilza1 a.123.1.1 (A:148-410) Thyroid hormone receptor alpha1 (TR-alpha1) {Human (Homo sapiens) [TaxId: 9606]}
eemirslqqrpeptpeewdlihiateahrstnaqgshwkqrrkflpddigqspivsmpdg
dkvdleafseftkiitpaitrvvdfakklpmfselpcedqiillkgccmeimslraavry
dpesdtltlsgemavkreqlkngglgvvsdaifelgkslsafnlddtevallqavllmst
drsgllcvdkieksqeayllafehyvnhrkhniphfwpkllmkvtdlrmigachasrflh
mkvecptelfpplflevfedqev

SCOPe Domain Coordinates for d3ilza1:

Click to download the PDB-style file with coordinates for d3ilza1.
(The format of our PDB-style files is described here.)

Timeline for d3ilza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ilza2