SCOPe 2.05: Domain d3il1b_: 3il1 B:

Lineage for d3il1b_ (3il1 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (43 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (134 PDB entries)

8. Domain d3il1b_: 3il1 B: [178375]
   automated match to d1ftja_
   complexed with b5d, glu, zn

Details for d3il1b_

PDB Entry: 3il1, 2 Å

PDB Description: crystal structure of the ampa subunit glur2 bound to the allosteric modulator, idra-21

PDB Compounds: (B:) Glutamate receptor 2

SCOPe Domain Sequences for d3il1b_:

Sequence; same for both SEQRES and ATOM records:

>d3il1b_ c.94.1.1 (B:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklse
qglldklknkwwydkgec

Timeline for d3il1b_:

• d3il1b_ first appeared in SCOPe 2.01
  
• d3il1b_ appears in SCOPe 2.04
  
• d3il1b_ appears in SCOPe 2.06
  
• d3il1b_ appears in the current release, SCOPe 2.08