SCOPe 2.08: Domain d3ik5c_: 3ik5 C:

Lineage for d3ik5c_ (3ik5 C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.102: Regulatory factor Nef [55670] (1 superfamily)
   alpha(2)-beta(4)-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.102.1: Regulatory factor Nef [55671] (2 families)

5. Family d.102.1.0: automated matches [191617] (1 protein)
   not a true family

6. Protein automated matches [191127] (2 species)
   not a true protein

7. Species Simian immunodeficiency virus [TaxId:388909] [189212] (2 PDB entries)

8. Domain d3ik5c_: 3ik5 C: [178363]
   automated match to d1efnb_

Details for d3ik5c_

PDB Entry: 3ik5, 2.05 Å

PDB Description: sivmac239 nef in complex with tcr zeta itam 1 polypeptide (a63-r80)

PDB Compounds: (C:) Protein Nef

SCOPe Domain Sequences for d3ik5c_:

Sequence, based on SEQRES records:

>d3ik5c_ d.102.1.0 (C:) automated matches {Simian immunodeficiency virus [TaxId: 388909]}
vsvrpkvplrtmsyklaidmshfikekgglegiyysarrhrildiylekeegiipdwqdy
tsgpgirypktfgwlwklvpvnvsdeaqedeehylmhpaqtsqwddpwgevlawkfdptl
aytyeayvrypeefg

Sequence, based on observed residues (ATOM records):

>d3ik5c_ d.102.1.0 (C:) automated matches {Simian immunodeficiency virus [TaxId: 388909]}
vsvrpkvplrtmsyklaidmshfikekgglegiyysarrhrildiylekeegiipdwqdy
tsgpgirypktfgwlwklvpvntsqwddpwgevlawkfdptlaytyeayvrypeefg

Timeline for d3ik5c_:

• d3ik5c_ first appeared in SCOPe 2.01
  
• d3ik5c_ appears in SCOPe 2.07