Lineage for d3ik3b_ (3ik3 B:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1929110Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1929111Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1929232Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1931583Protein automated matches [190091] (12 species)
    not a true protein
  7. 1932437Species Mouse (Mus musculus) [TaxId:10090] [187169] (35 PDB entries)
  8. 1932458Domain d3ik3b_: 3ik3 B: [178361]
    automated match to d1opjb_
    complexed with 0li; mutant

Details for d3ik3b_

PDB Entry: 3ik3 (more details), 1.9 Å

PDB Description: ap24534, a pan-bcr-abl inhibitor for chronic myeloid leukemia, potently inhibits the t315i mutant and overcomes mutation-based resistance
PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d3ik3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ik3b_ d.144.1.7 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gspnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkea
avmkeikhpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevsavvllymatqi
ssameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwta
peslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpek
vyelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkr

SCOPe Domain Coordinates for d3ik3b_:

Click to download the PDB-style file with coordinates for d3ik3b_.
(The format of our PDB-style files is described here.)

Timeline for d3ik3b_: