Lineage for d3ik3b1 (3ik3 B:229-513)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (20 species)
    not a true protein
  7. 2546088Species Mouse (Mus musculus) [TaxId:10090] [187169] (38 PDB entries)
  8. 2546105Domain d3ik3b1: 3ik3 B:229-513 [178361]
    Other proteins in same PDB: d3ik3a2, d3ik3b2
    automated match to d1opjb_
    complexed with 0li; mutant

Details for d3ik3b1

PDB Entry: 3ik3 (more details), 1.9 Å

PDB Description: AP24534, a Pan-BCR-ABL Inhibitor for Chronic Myeloid Leukemia, Potently Inhibits the T315I Mutant and Overcomes Mutation-Based Resistance
PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d3ik3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ik3b1 d.144.1.7 (B:229-513) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
spnydkwemertditmkhklgggqygevyegvwkkysltvavktlkedtmeveeflkeaa
vmkeikhpnlvqllgvctreppfyiiiefmtygnlldylrecnrqevsavvllymatqis
sameylekknfihrdlaarnclvgenhlvkvadfglsrlmtgdtytahagakfpikwtap
eslaynkfsiksdvwafgvllweiatygmspypgidlsqvyellekdyrmerpegcpekv
yelmracwqwnpsdrpsfaeihqafetmfqessisdevekelgkr

SCOPe Domain Coordinates for d3ik3b1:

Click to download the PDB-style file with coordinates for d3ik3b1.
(The format of our PDB-style files is described here.)

Timeline for d3ik3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ik3b2